服務熱線
400-021-2200
現貨供應，歡迎訂購: :
B-type Natriuretic Peptide Human Recombinant
2µg
10µg
1mg
| Catalogue Number | CYT-327 | ||
| Synonyms | NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide. | ||
| Introduction | Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function. | ||
| Description | B-type Natriuretic Peptide Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. NPPB is purified by proprietary chromatographic techniques. | ||
| Source | Escherichia Coli. | ||
| Physical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. | ||
| Formulation | Natriuretic Peptide Precursor B was lyophilized from 0.4ml PBS buffer containing 20mM phosphate buffer and 0.6mM sodium chloride. | ||
| Solubility | It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. | ||
| Stability | Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution NPPB should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | ||
| Purity | Greater than 95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. | ||
| Amino acid sequence | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH. | ||
| Usage | Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. | ||
| Related Products |
|
Related Products
Activin A cyt-569 Hystemcell.cn Recombinant Human Activin-A
Activin A Plant-Active cyt-414 Hystemcell.cn Recombinant Human Activin-A Active
Activin A HEK-Active cyt-078 Hystemcell.cn Recombinant Human Activin-A HEK-Active
Activin A Plant cyt-052 Hystemcell.cn Recombinant Human Activin-A, Plant
Activin B Active cyt-057 Hystemcell.cn Recombinant Human Activin-B Active
Activin B cyt-058 Hystemcell.cn Recombinant Human Activin-B
Activin A, Active cyt-145 Hystemcell.cn Recombinant Human Activin-A, Active
mActivin A cyt-146 Hystemcell.cn Recombinant Mouse Activin-A
rActivin A cyt-147 Hystemcell.cn Recombinant Rat Activin-A
Acrp30 cyt-024 Human Adiponectin
Acrp30 cyt-280 Hystemcell.cn Recombinant Human Adiponectin
Acrp30 His cyt-433 Hystemcell.cn Recombinant Human Adiponectin, His tag
mAcrp30 His cyt-537 Hystemcell.cn Recombinant Mouse Adiponectin, His tag
Acrp30 HEK cyt-434 Hystemcell.cn Recombinant Human Adiponectin glycosilated, HEK
mAcrp30 HEK cyt-435 Hystemcell.cn Recombinant Mouse Adiponectin glycosilated, HEK
pAcrp30 HEK cyt-696 Hystemcell.cn Recombinant Porcine Adiponectin glycosilated, HEK
Acrp30 Tri cyt-233 Hystemcell.cn Recombinant Human Adiponectin Trimeric Form
mAcrp30 Tri cyt-247 Hystemcell.cn Recombinant Mouse Adiponectin Trimeric Form
gAcrp30 cyt-615 Hystemcell.cn Recombinant Human Adiponectin Globular
gAcrp30 His cyt-277 Hystemcell.cn Recombinant Human Adiponectin Globular, His tag
mgAcrp30 cyt-432 Hystemcell.cn Recombinant Mouse Adiponectin Globular
AIF1 cyt-697 Hystemcell.cn Recombinant Human Allograft Inflammatory Factor 1
AIF1L cyt-007 Hystemcell.cn Recombinant Human Allograft Inflammatory Factor 1 Like
AITRL cyt-076 Hystemcell.cn Recombinant Human AITRL
AITRL His cyt-317 Hystemcell.cn Recombinant Human AITRL, His Tag
ANGPT1 cyt-074 Hystemcell.cn Recombinant Human Angiopoietin-1
ANGPTL3 cyt-248 Hystemcell.cn Recombinant Human Angiopoietin-like Protein 3
ANGPTL4 cyt-249 Hystemcell.cn Recombinant Human Angiopoietin-like Protein 4
ANGPTL4 HEK cyt-698 Hystemcell.cn Recombinant Human Angiopoietin-like Protein 4, HEK
APOA1 cyt-661 Hystemcell.cn Recombinant Human Apolipoprotein A-I
APOA1 cyt-037 Human Apolipoprotein A-I
APOA2 cyt-038 Human Apolipoprotein A-II
APOA5 cyt-025 Hystemcell.cn Recombinant Human Apolipoprotein A-V
AREG cyt-041 Hystemcell.cn Recombinant Human Amphiregulin
Clusterin cyt-278 Hystemcell.cn Recombinant Human Apoliprotein-J
Clusterin cyt-548 Human Apoliprotein-J
rClusterin cyt-437 Hystemcell.cn Recombinant Rat Apoliprotein-J
k9Clusterin cyt-549 Hystemcell.cn Recombinant Canine Apoliprotein-J
k9Clusterin HEK cyt-618 Hystemcell.cn Recombinant Canine Apoliprotein-J HEK
APO D cyt-547 Hystemcell.cn Recombinant Human Apoliprotein-D
APO D GST cyt-652 Hystemcell.cn Recombinant Human APO-D GST Tag
APOH cyt-189 Hystemcell.cn Recombinant Human Apoliprotein-H
APOM cyt-715 Hystemcell.cn Recombinant Human Apolipoprotein-M
APOM HEK cyt-026 Hystemcell.cn Recombinant Human Apolipoprotein-M, HEK
Artemin cyt-306 Hystemcell.cn Recombinant Human Artemin
BD 1 cyt-564 Hystemcell.cn Recombinant Human Beta Defensin -1
mBD 1 cyt-044 Hystemcell.cn Recombinant Mouse Beta Defensin -1
rBD 1 cyt-062 Hystemcell.cn Recombinant Rat Beta Defensin -1
BD 2 cyt-571 Hystemcell.cn Recombinant Human Beta Defensin -2
mBD 2 cyt-035 Hystemcell.cn Recombinant Mouse Beta Defensin -2
BD 3 cyt-461 Hystemcell.cn Recombinant Human Beta Defensin -3
mBD 3 cyt-036 Hystemcell.cn Recombinant Mouse Beta Defensin -3
rBD 3 cyt-063 Hystemcell.cn Recombinant Rat Beta Defensin -3
BD 4 cyt-599 Hystemcell.cn Recombinant Human Beta Defensin -4
rBD 4 cyt-066 Hystemcell.cn Recombinant Rat Beta Defensin -4
BDNF cyt-207 Hystemcell.cn Recombinant Human Brain-Derived Neurotrophic Factor
proBDNF cyt-014 Hystemcell.cn Recombinant Human Precursor Brain-Derived Neurotrophic Factor
BAFF cyt-307 Hystemcell.cn Recombinant Human BAFF (BLyS)
BAFF His cyt-545 Hystemcell.cn Recombinant Human BAFF (BLyS), His Tag
BAFF Plant cyt-054 Hystemcell.cn Recombinant Human BAFF (BLyS), Plant
BAFF R cyt-429 Hystemcell.cn Recombinant Human BAFF (BLyS) Receptor
BMPR1A cyt-380 Hystemcell.cn Recombinant Human Bone Morphogenetic protein Receptor-1A
BMPR1A HEK cyt-713 Hystemcell.cn Recombinant Human Bone Morphogenetic protein Receptor-1A HEK
BMP 2 cyt-261 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-2
BMP 2 HEK cyt-080 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-2, HEK
BMP 2 Mono cyt-627 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-2 Monomer
Pro BMP 2 cyt-427 Hystemcell.cn Recombinant Human Pro Bone Morphogenetic protein-2
BMP 4 cyt-361 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-4
BMP 4 Active cyt-081 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-4 Active
BMP 5 cyt-660 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-5
BMP 7 cyt-333 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-7
BMP 7 His cyt-629 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-7 His Tag
BMP 7 CHO cyt-276 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-7, CHO
BMP 7 Plant cyt-039 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-7, Plant
BMP 7 HEK cyt-082 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-7, HEK
b NGF cyt-579 Hystemcell.cn Recombinant Human beta Nerve Growth Factor
b NGF CHO cyt-246 Hystemcell.cn Recombinant Human beta Nerve Growth Factor, CHO
b NGF HEK cyt-079 Hystemcell.cn Recombinant Human beta Nerve Growth Factor, HEK
mb NGF cyt-581 Hystemcell.cn Recombinant Mouse beta Nerve Growth Factor
mb NGF cyt-440 Mouse beta Nerve Growth Factor
ProNGF cyt-426 Hystemcell.cn Recombinant Human Pro-Nerve Growth Factor
BNP cyt-327 Hystemcell.cn Recombinant Human B-type Natriuretic Protein
BNP His cyt-605 Hystemcell.cn Recombinant Human B-type Natriuretic Protein His Tag
BNP cyt-369 Human B-type Natriuretic Protein
BST2 cyt-059 Hystemcell.cn Recombinant Human Bone Marrow Stromal Cell Antigen 2
BTC cyt-330 Hystemcell.cn Recombinant Human Betacellulin
BTC His cyt-077 Hystemcell.cn Recombinant Human Betacellulin, His Tag
mBTC cyt-131 Hystemcell.cn Recombinant Mouse Betacellulin
bBTC cyt-406 Hystemcell.cn Recombinant Bovine Betacellulin
CDNF cyt-167 Hystemcell.cn Recombinant Human Cerebral Dopamine Neurotrophic Factor
mCDNF cyt-729 Hystemcell.cn Recombinant Mouse Cerebral Dopamine Neurotrophic Factor
rCDNF cyt-730 Hystemcell.cn Recombinant Rat Cerebral Dopamine Neurotrophic Factor
CLCF1 cyt-071 Hystemcell.cn Recombinant Human Cardiotrophin-Like Cytokine Factor 1
CNTF cyt-272 Hystemcell.cn Recombinant Human Ciliary Neurotrophic Factor
CNTF His cyt-573 Hystemcell.cn Recombinant Human Ciliary Neurotrophic Factor, His Tag
mCNTF cyt-139 Hystemcell.cn Recombinant Mouse Ciliary Neurotrophic Factor
rCNTF cyt-654 Hystemcell.cn Recombinant Rat Ciliary Neurotrophic Factor
CT 1 cyt-436 Hystemcell.cn Recombinant Human Cardiotrophin-1
mCT 1 cyt-151 Hystemcell.cn Recombinant Mouse Cardiotrophin-1
rCT 1 cyt-199 Hystemcell.cn Recombinant Rat Cardiotrophin-1
CTGF cyt-541 Hystemcell.cn Recombinant Human Connective Tissue Growth Factor
CTGF His cyt-438 Hystemcell.cn Recombinant Human Connective Tissue Growth Factor, His Tag
CTGF (182-250 a.a.) cyt-526 Hystemcell.cn Recombinant Human Connective Tissue Growth Factor 182-250 a.a.
CTGF HEK cyt-687 Hystemcell.cn Recombinant Human Connective Tissue Growth Factor, HEK
CTLA 4 cyt-366 Hystemcell.cn Recombinant Human Cytotoxic T-Lymphocyte Associated Antigen-4
CYR61 cyt-164 Hystemcell.cn Recombinant Human Cysteine-Rich Angiogenic Inducer 61
EBI3 cyt-367 Hystemcell.cn Recombinant Human Epstein Barr Virus Induced 3
EBI3 His cyt-668 Hystemcell.cn Recombinant Human Epstein Barr Virus Induced 3, His Tag
mEBI3 cyt-621 Hystemcell.cn Recombinant Mouse Epstein Barr Virus Induced 3
EG VEGF cyt-338 Hystemcell.cn Recombinant Human Endocrine Gland Vacular Endothelial Growth Factor
EGF cyt-217 Hystemcell.cn Recombinant Human Epidermal Growth Factor
EGF Pichia cyt-332 Hystemcell.cn Recombinant Human Epidermal Growth Factor, Pichia
EGF (Leu 21) cyt-466 Hystemcell.cn Recombinant Human Epidermal Growth Factor 21-Leu
mEGF cyt-326 Hystemcell.cn Recombinant Mouse Epidermal Growth Factor
mEGF cyt-554 Mouse Epidermal Growth Factor
mEGF, His cyt-138 Hystemcell.cn Recombinant Mouse Epidermal Growth Factor, His
rEGF cyt-556 Rat Epidermal Growth Factor
rEGF cyt-669 Hystemcell.cn Recombinant Rat Epidermal Growth Factor
EMAP II cyt-607 Hystemcell.cn Recombinant Human Endothelial-Monocyte Activating Polypeptide II
AIMP1 cyt-021 Hystemcell.cn Recombinant Human Aminoacyl tRNA Synthetase Complex-Interacting Multifunctional Protein 1
Endoglin Sf9 cyt-389 Hystemcell.cn Recombinant Human Endoglin, Sf9
Endoglin cyt-525 Hystemcell.cn Recombinant Human Endoglin
mEndoglin cyt-424 Hystemcell.cn Recombinant Mouse Endoglin
EPGN cyt-601 Hystemcell.cn Recombinant Human Epigen
EREG cyt-609 Hystemcell.cn Recombinant Human Epiregulin
EPO a cyt-201 Hystemcell.cn Recombinant Human Erythropoietin-alpha
EPO a Fc cyt-325 Hystemcell.cn Recombinant Human Erythropoietin-alpha Fc/Chimera
EPO a HEK cyt-083 Hystemcell.cn Recombinant Human Erythropoietin-alpha, HEK
FAS cyt-125 Hystemcell.cn Recombinant Human sFas Receptor
FASLG cyt-031 Hystemcell.cn Recombinant Human FAS Ligand
FASLG HEK cyt-051 Hystemcell.cn Recombinant Human FAS Ligand, HEK
FGF 1 cyt-264 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-acidic
FGF 1 Sf9 cyt-364 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-acidic, Sf9
mFGF 1 cyt-528 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-acidic
mFGF 1 His cyt-072 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-acidic, His Tag
rFGF 1 cyt-075 Hystemcell.cn Recombinant Rat Fibroblast Growth Factor-acidic
baFGF cyt-613 Bovine Fibroblast Growth Factor-acidic
FGF 2 cyt-218 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-basic
FGF 2 Sf9 cyt-365 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-basic, Sf9
FGF 2 (147 a.a.) cyt-557 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-basic (147 a.a)
FGF 2 293 Cells cyt-085 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-basic, 293 Cells
FGF2 Plant cyt-123 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-basic, Plant
bFGF 2 cyt-288 Hystemcell.cn Recombinant Bovine Fibroblast Growth Factor-basic
bFGF 2 cyt-560 Bovine Fibroblast Growth Factor-basic
mFGF 2 cyt-386 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-basic
rFGF 2 cyt-608 Hystemcell.cn Recombinant Rat Fibroblast Growth Factor-basic
FGF 4 cyt-312 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-4
FGF 4 HEK cyt-084 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-4, HEK
FGF 8 cyt-714 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-8
mFGF 8 cyt-070 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-8
FGF 8 HEK cyt-087 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-8, HEK
FGF 9 cyt-415 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-9
mFGF 9 cyt-349 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-9
rFGF 9 cyt-558 Hystemcell.cn Recombinant Rat Fibroblast Growth Factor-9
FGF12 cyt-620 Hystemcell.cn Recombinant Human Fibroblast Growth Factor 12
FGF13 cyt-121 Hystemcell.cn Recombinant Human Fibroblast Growth Factor 13
mFGF-15 cyt-027 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-15
FGF-18 cyt-120 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-18
mFGF-18 cyt-064 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-18
rFGF-18 cyt-176 Hystemcell.cn Recombinant Rat Fibroblast Growth Factor-18
FGF 19 cyt-700 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-19
FGF 19 His cyt-279 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-19 His Tag
FGF 21 cyt-474 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-21
FGF 21 His cyt-281 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-21, His Tag
mFGF 21 cyt-339 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-21
mFGF 21 His cyt-516 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-21, His Tag
rFGF 21 cyt-130 Hystemcell.cn Recombinant Rat Fibroblast Growth Factor-21
bFGF 21 cyt-657 Hystemcell.cn Recombinant Bovine Fibroblast Growth Factor-21
FGF 22 cyt-428 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-22
FGF 23 cyt-020 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-23
FGF 23 His cyt-374 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-23 His Tag
FGF 23 C-term cyt-028 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-23 C-Terminal
Flt3 Ligand cyt-331 Hystemcell.cn Recombinant Human Flt3-Ligand
Flt3 Ligand HEK cyt-706 Hystemcell.cn Recombinant Human Flt3-Ligand, HEK
Flt3 Ligand Sf9 cyt-409 Hystemcell.cn Recombinant Human Flt3-Ligand, Sf9
mFlt3 Ligand cyt-340 Hystemcell.cn Recombinant Mouse Flt3-Ligand
rmFlt3 Ligand cyt-157 Hystemcell.cn Recombinant Rhesus Macaque Flt3-Ligand
FST cyt-232 Hystemcell.cn Recombinant Human Follistatin
FST His cyt-029 Hystemcell.cn Recombinant Human Follistatin His Tag
mFST cyt-124 Hystemcell.cn Recombinant Mouse Follistatin
HB-EGF cyt-119 Hystemcell.cn Recombinant Human Proheparin-Binding EGF-like Growth Factor
mHB-EGF cyt-068 Hystemcell.cn Recombinant Mouse Proheparin-Binding EGF-like Growth Factor
rHB-EGF cyt-170 Hystemcell.cn Recombinant Rat Proheparin-Binding EGF-like Growth Factor
LGALS1 cyt-544 Hystemcell.cn Recombinant Human Galectin-1
mLGALS1 cyt-186 Hystemcell.cn Recombinant Mouse Galectin-1
LGALS2 cyt-725 Hystemcell.cn Recombinant Human Galectin-2
mLGALS2 cyt-019 Hystemcell.cn Recombinant Mouse Galectin-2
LGALS3 cyt-606 Hystemcell.cn Recombinant Human Galectin-3
LGALS3 His cyt-693 Hystemcell.cn Recombinant Human Galectin-3 His Tag
mLGALS3 cyt-188 Hystemcell.cn Recombinant Mouse Galectin-3
LGALS4 cyt-686 Hystemcell.cn Recombinant Human Galectin-4
mLGALS4 cyt-187 Hystemcell.cn Recombinant Mouse Galectin-4
LGALS7 cyt-016 Hystemcell.cn Recombinant Human Galectin-7
LGALS7 His cyt-617 Hystemcell.cn Recombinant Human Galectin-7 His Tag
mLGALS7 cyt-184 Hystemcell.cn Recombinant Mouse Galectin-7
LGALS8 cyt-017 Hystemcell.cn Recombinant Human Galectin-8
LGALS8 His cyt-727 Hystemcell.cn Recombinant Human Galectin-8, His Tag
mLGALS8 cyt-185 Hystemcell.cn Recombinant Mouse Galectin-8
LGALS9 cyt-708 Hystemcell.cn Recombinant Human Galectin-9
mLGALS9 cyt-550 Hystemcell.cn Recombinant Mouse Galectin-9
LGALS13 cyt-004 Hystemcell.cn Recombinant Human Galectin-13
LGALS14 cyt-003 Hystemcell.cn Recombinant Human Galectin-14
LGALSL cyt-073 Hystemcell.cn Recombinant Human Galectin-Related Protein
GDNF cyt-305 Hystemcell.cn Recombinant Human Glial-Derived Neurotrophic Factor
GDF3 cyt-694 Hystemcell.cn Recombinant Human Growth and Differentiation factor 3
GDF5 cyt-442 Hystemcell.cn Recombinant Human Growth and Differentiation factor 5
GDF5 His cyt-653 Hystemcell.cn Recombinant Human Growth and Differentiation factor 5 His Tag
GDF10 cyt-659 Hystemcell.cn Recombinant Human Growth and Differentiation factor 10
GDF15 His cyt-691 Hystemcell.cn Recombinant Human Growth and Differentiation factor 15, His Tag
GDF15 D cyt-314 Hystemcell.cn Recombinant Human Growth and Differentiation factor 15 D-Vairant
GDF15 cyt-335 Hystemcell.cn Recombinant Human Growth and Differentiation factor 15
G CSF cyt-220 Hystemcell.cn Recombinant Human Granulocyte-Colony Stimulating Factor
G CSF His cyt-476 Hystemcell.cn Recombinant Human Granulocyte-Colony Stimulating Factor, His Tag
G CSF CHO cyt-329 Hystemcell.cn Recombinant Human Granulocyte-Colony Stimulating Factor, CHO
G CSF PEG cyt-018 Hystemcell.cn Recombinant Human Pegylated Granulocyte-Colony Stimulating Factor
G CSF HEK cyt-088 Hystemcell.cn Recombinant Human Granulocyte-Colony Stimulating Factor, HEK
mG CSF cyt-410 Hystemcell.cn Recombinant Mouse Granulocyte-Colony Stimulating Factor
GH cyt-202 Hystemcell.cn Recombinant Human Growth Hormone
pGH 22kDa cyt-235 Hystemcell.cn Recombinant Human Placental Corr Growth Hormone
GH 20kDa cyt-259 Hystemcell.cn Recombinant Human Pituitary Growth Hormone 20kDa
pGH 20kDa cyt-337 Hystemcell.cn Recombinant Human Placental Growth Hormone 20kDa
GH Plant cyt-053 Hystemcell.cn Recombinant Human Growth Hormone, Plant
GH HEK cyt-091 Hystemcell.cn Recombinant Human Growth Hormone, HEK
GHBP cyt-238 Hystemcell.cn Recombinant Human Growth Hormone Binding Protein
oGHBP cyt-470 Hystemcell.cn Recombinant Ovine Growth Hormone Binding Protein
bGHBP cyt-471 Hystemcell.cn Recombinant Bovine Growth Hormone Binding Protein
raGHBP cyt-593 Hystemcell.cn Recombinant Rabbit Growth Hormone Binding Protein
chGH cyt-430 Hystemcell.cn Recombinant Chicken Growth Hormone
oGH cyt-237 Hystemcell.cn Recombinant Ovine Growth Hormone
oGH Placental cyt-594 Hystemcell.cn Recombinant Placental Ovine Growth Hormone
bGH cyt-636 Hystemcell.cn Recombinant Bovine Growth Hormone
mGH cyt-540 Hystemcell.cn Recombinant Mouse Growth Hormone
rGH cyt-296 Hystemcell.cn Recombinant Rat Growth Hormone
cGH cyt-297 Hystemcell.cn Recombinant Carp Growth Hormone
dGH cyt-498 Hystemcell.cn Recombinant Denis Growth Hormone
maiGH cyt-499 Hystemcell.cn Recombinant Mai Mai Growth Hormone
sGH cyt-529 Hystemcell.cn Recombinant Gilthead Seabream Growth Hormone
raGH cyt-514 Hystemcell.cn Recombinant Rabbit Growth Hormone
pGH cyt-519 Hystemcell.cn Recombinant Porcine Growth Hormone
chGH Antagonist cyt-538 Hystemcell.cn Recombinant Chicken Growth Hormone Anatagonist
oGH Antagonist cyt-215 Hystemcell.cn Recombinant Ovine Growth Hormone Anatagonist
zGH cyt-710 Hystemcell.cn Recombinant Zebrafish Growth Hormone
zGH Mutant cyt-709 Hystemcell.cn Recombinant Zebrafish Growth Hormone Mutant
GM CSF cyt-221 Hystemcell.cn Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor
GM CSF Pichia cyt-324 Hystemcell.cn Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, Pichia
GM CSF Sf9 cyt-416 Hystemcell.cn Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, Sf9
GM CSF HEK cyt-089 Hystemcell.cn Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, HEK
GM CSF His cyt-477 Hystemcell.cn Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, His Tag
PIXY321 cyt-360 Hystemcell.cn Recombinant Human gm-csf/IL-3 Fusion Protein (PIXY321)
mGM CSF cyt-222 Hystemcell.cn Recombinant Mouse Granulocyte Macrophage-Colony Stimulating Factor
rGM CSF cyt-395 Hystemcell.cn Recombinant Rat Granulocyte Macrophage-Colony Stimulating Factor
pGM CSF cyt-401 Hystemcell.cn Recombinant Porcine Granulocyte Macrophage-Colony Stimulating Factor
rmGM CSF cyt-720 Hystemcell.cn Recombinant Rhesus Macaque Granulocyte Macrophage-Colony Stimulating Factor
k9GM CSF cyt-724 Hystemcell.cn Recombinant Canine Granulocyte Macrophage-Colony Stimulating Factor
GMF b cyt-565 Hystemcell.cn Recombinant Human Glia Maturation Factor Beta
GMF b His cyt-726 Hystemcell.cn Recombinant Human Glia Maturation Factor Beta His Tag
mGMF b cyt-006 Hystemcell.cn Recombinant Mouse Glia Maturation Factor Beta
rGMF b cyt-049 Hystemcell.cn Recombinant Rat Glia Maturation Factor Beta
GMFG cyt-632 Hystemcell.cn Recombinant Human Glia Maturation Factor Gamma
HDGF cyt-681 Hystemcell.cn Recombinant Human Hepatoma-Derived Growth Factor
HDGF2 cyt-132 Hystemcell.cn Recombinant Human Hepatoma-Derived Growth Factor-2
HGF CHO cyt-251 Hystemcell.cn Recombinant Human Hepatocyte Growth Factor, CHO
HGF Sf9 cyt-244 Hystemcell.cn Recombinant Human Hepatocyte Growth Factor, Sf9
HGF HEK cyt-090 Hystemcell.cn Recombinant Human Hepatocyte Growth Factor, HEK
HGF-A cyt-664 Hystemcell.cn Recombinant Human Hepatocyte Growth Factor A Chain
HGF-B cyt-665 Hystemcell.cn Recombinant Human Hepatocyte Growth Factor B Chain
pHGF cyt-522 Porcine Hepatocyte Promoting Growth Factor
IFI30 cyt-183 Hystemcell.cn Recombinant Human Interferon Gamma-Inducible protein 30
IFN a 1 cyt-291 Hystemcell.cn Recombinant Human Interferon-alpha 1
IFN a 1a cyt-520 Hystemcell.cn Recombinant Human Interferon-alpha 1a
IFN a 1b cyt-283 Hystemcell.cn Recombinant Human Interferon-alpha 1b
IFN a 2a cyt-204 Hystemcell.cn Recombinant Human Interferon-alpha 2a
IFN a 2a Plant cyt-543 Hystemcell.cn Recombinant Human Interferon-alpha 2a, Tobacco
IFN a 2b cyt-205 Hystemcell.cn Recombinant Human Interferon-alpha 2b
IFN a 2b Yeast cyt-460 Hystemcell.cn Recombinant Human Interferon-alpha 2b, Saccharomyces
IFN a 2b 20kd-PEG cyt-034 Hystemcell.cn Recombinant Human Interferon-alpha 2b 20kd-Pegylated
IFN a 2b HEK cyt-092 Hystemcell.cn Recombinant Human Interferon-alpha 2b, HEK
IFN a 2a HEK cyt-093 Hystemcell.cn Recombinant Human Interferon-alpha 2a, HEK
IFNA7 cyt-196 Hystemcell.cn Recombinant Human Interferon-alpha 7
IFNA14 cyt-135 Hystemcell.cn Recombinant Human Interferon-alpha 14
IFN b 1a cyt-236 Hystemcell.cn Recombinant Human Interferon-beta 1a
IFN b 1b cyt-234 Hystemcell.cn Recombinant Human Interferon-beta 1b
mIFN b His cyt-651 Hystemcell.cn Recombinant Mouse Interferon-beta His Tag
IFN g cyt-206 Hystemcell.cn Recombinant Human Interferon-gamma
IFN g His cyt-478 Hystemcell.cn Recombinant Human Interferon-gamma His Tag
mIFN g cyt-358 Hystemcell.cn Recombinant Mouse Interferon-gamma
rIFN g cyt-359 Hystemcell.cn Recombinant Rat Interferon-gamma
pIFN g cyt-402 Hystemcell.cn Recombinant Porcine Interferon-gamma
qIFN g cyt-739 Hystemcell.cn Recombinant Equine Interferon-gamma
IFNW1 cyt-040 Hystemcell.cn Recombinant Human Interferon-Omega 1
oIFN tau cyt-377 Hystemcell.cn Recombinant Ovine Interferon-Tau
IRF 1 cyt-449 Hystemcell.cn Recombinant Human Interferon Regulatory Factor-1
IRF 2 cyt-534 Hystemcell.cn Recombinant Human Interferon Regulatory Factor-2
IRF 3 cyt-292 Hystemcell.cn Recombinant Human Interferon Regulatory Factor-3
IGF1 cyt-216 Hystemcell.cn Recombinant Human Insulin Like Growth Factor-1
IGF1 GST cyt-690 Hystemcell.cn Recombinant Human Insulin Like Growth Factor-1, GST-Tag
IGF1 Des1-3 cyt-518 Hystemcell.cn Recombinant Human Insulin Like Growth Factor-1 Des (1-3)
Long R3 IGF1 cyt-022 Hystemcell.cn Recombinant Human LR3 Insulin Like Growth Factor-1
IGF1 N15 cyt-128 Hystemcell.cn Recombinant Human Insulin Like Growth Factor-1 N15 Labeled
mIGF1 cyt-229 Hystemcell.cn Recombinant Mouse Insulin Like Growth Factor-1
rIGF1 cyt-289 Hystemcell.cn Recombinant Rat Insulin Like Growth Factor-1
sIGF1 cyt-295 Hystemcell.cn Recombinant Gilthead Seabream Insulin Like Growth Factor-1
IGF2 cyt-265 Hystemcell.cn Recombinant Human Insulin Like Growth Factor-2
pro-IGF2 cyt-110 Hystemcell.cn Recombinant Human Pro-Insulin Like Growth Factor-2
IGFBP 1 cyt-299 Human Insulin Like Growth Factor Binding Protein-1
IGFBP 3 cyt-300 Hystemcell.cn Recombinant Human Insulin Like Growth Factor Binding Protein-3
IGFBP 4 cyt-030 Hystemcell.cn Recombinant Human Insulin Like Growth Factor Binding Protein-4
IGFBP 5 cyt-464 Hystemcell.cn Recombinant Human Insulin Like Growth Factor Binding Protein-5
IGFBP 6 cyt-258 Hystemcell.cn Recombinant Human Insulin Like Growth Factor Binding Protein-6
IHH cyt-195 Hystemcell.cn Recombinant Human Indian Hedgehog
IL 1 alpha cyt-253 Hystemcell.cn Recombinant Human Interleukin-1 alpha
IL 1 alpha His cyt-479 Hystemcell.cn Recombinant Human Interleukin-1 alpha, His Tag
mIL 1 alpha cyt-523 Hystemcell.cn Recombinant Mouse Interleukin-1 alpha
rIL 1 alpha cyt-381 Hystemcell.cn Recombinant Rat Interleukin-1 alpha
pIL 1 alpha cyt-396 Hystemcell.cn Recombinant Porcine Interleukin-1 alpha
IL 1 beta cyt-208 Hystemcell.cn Recombinant Human Interleukin-1 beta
IL 1 beta His cyt-480 Hystemcell.cn Recombinant Human Interleukin-1 beta, His Tag
IL 1 beta HEK cyt-094 Hystemcell.cn Recombinant Human Interleukin-1 beta, HEK
mIL 1 beta cyt-273 Hystemcell.cn Recombinant Mouse Interleukin-1 beta
mIL 1 beta His cyt-578 Hystemcell.cn Recombinant Mouse Interleukin-1 beta, His Tag
rIL 1 beta cyt-394 Hystemcell.cn Recombinant Rat Interleukin-1 beta
pIL 1 beta cyt-400 Hystemcell.cn Recombinant Porcine Interleukin-1 beta
rmIL 1 beta cyt-718 Hystemcell.cn Recombinant Rhesus Macaque Interleukin-1 beta
IL 1RA cyt-203 Hystemcell.cn Recombinant Human Interleukin-1 Receptor Antagonist
IL 1RA His cyt-481 Hystemcell.cn Recombinant Human Interleukin-1 Receptor Antagonist, His Tag
IL1RL1 cyt-671 Hystemcell.cn Recombinant Human Interleukin-1 Receptor Like-1
mIL 1RA cyt-658 Hystemcell.cn Recombinant Mouse Interleukin-1 Receptor Antagonist
mIL 1RA His cyt-136 Hystemcell.cn Recombinant Mouse Interleukin-1 Receptor Antagonist, His Tag
rIL 1RA cyt-152 Hystemcell.cn Recombinant Rat Interleukin-1 Receptor Antagonist
hIL 1RA cyt-010 Hystemcell.cn Recombinant Horse Interleukin-1 Receptor Antagonist
IL 2 cyt-209 Hystemcell.cn Recombinant Human Interleukin-2
IL 2 His cyt-666 Hystemcell.cn Recombinant Human Interleukin-2 His Tag
IL 2 HEK cyt-095 Hystemcell.cn Recombinant Human Interleukin 2, HEK
mIL 2 cyt-370 Hystemcell.cn Recombinant Mouse Interleukin-2
mIL 2 His cyt-624 Hystemcell.cn Recombinant Mouse Interleukin-2, His Tag
rIL 2 cyt-382 Hystemcell.cn Recombinant Rat Interleukin-2
pIL 2 cyt-397 Hystemcell.cn Recombinant Porcine Interleukin-2
qIL2 cyt-738 Hystemcell.cn Recombinant Equine Interleukin-2
sIL 2R cyt-285 Hystemcell.cn Recombinant Human Soluble Iinterleukin-2 Receptor alpha
IL 3 cyt-210 Hystemcell.cn Recombinant Human Interleukin-3
IL 3 His cyt-482 Hystemcell.cn Recombinant Human Interleukin-3, His Tag
IL 3 HEK cyt-096 Hystemcell.cn Recombinant Human Interleukin 3, HEK
mIL 3 cyt-371 Hystemcell.cn Recombinant Mouse Interleukin-3
rIL 3 cyt-383 Hystemcell.cn Recombinant Rat Interleukin-3
IL 3 Sf9 cyt-417 Hystemcell.cn Recombinant Human Interleukin-3, Sf9
k9 IL 3 cyt-722 Hystemcell.cn Recombinant Canine Interleukin-3
rmIL3 cyt-156 Hystemcell.cn Recombinant Rhesus Macaque Interleukin-3
IL 4 cyt-211 Hystemcell.cn Recombinant Human Interleukin-4
IL 4 CHO cyt-271 Hystemcell.cn Recombinant Human Interleukin-4 CHO
IL 4 His cyt-483 Hystemcell.cn Recombinant Human Interleukin-4, His Tag
IL 4 HEK cyt-097 Hystemcell.cn Recombinant Human Interleukin 4, HEK
mIL 4 cyt-282 Hystemcell.cn Recombinant Mouse Interleukin-4
rIL 4 cyt-385 Hystemcell.cn Recombinant Rat Interleukin-4
pIL 4 cyt-398 Hystemcell.cn Recombinant Porcine Interleukin-4
rmIL4 cyt-172 Hystemcell.cn Recombinant Rhesus Macaque Interleukin-4
IL 5 cyt-212 Hystemcell.cn Recombinant Human Interleukin-5
mIL 5 cyt-689 Hystemcell.cn Recombinant Mouse Interleukin-5
rIL 5 cyt-387 Hystemcell.cn Recombinant Rat Interleukin-5
IL 6 cyt-213 Hystemcell.cn Recombinant Human Interleukin-6
IL 6 CHO cyt-274 Hystemcell.cn Recombinant Human Interleukin-6, CHO
IL 6 His cyt-484 Hystemcell.cn Recombinant Human Interleukin-6, His Tag
IL 6 HEK cyt-098 Hystemcell.cn Recombinant Human Interleukin 6, HEK
mIL 6 cyt-350 Hystemcell.cn Recombinant Mouse Interleukin-6
rIL 6 cyt-388 Hystemcell.cn Recombinant Rat Interleukin-6
pIL 6 cyt-399 Hystemcell.cn Recombinant Porcine Interleukin-6
rmIL 6 cyt-174 Hystemcell.cn Recombinant Rhesus Macaque Interleukin-6
sIL 6R cyt-286 Hystemcell.cn Recombinant Human Soluble IL-6 Receptor alpha
IL 7 cyt-254 Hystemcell.cn Recombinant Human Interleukin-7
IL 7 Yeast cyt-298 Hystemcell.cn Recombinant Human Interleukin-7, Saccharomyces
IL 7 His cyt-485 Hystemcell.cn Recombinant Human Interleukin-7, His Tag
IL 7, HEK cyt-197 Hystemcell.cn Recombinant Human Interleukin-7, HEK
mIL 7 cyt-372 Hystemcell.cn Recombinant Mouse Interleukin-7
rIL 7 cyt-163 Hystemcell.cn Recombinant Rat Interleukin-7
IL 9 cyt-348 Hystemcell.cn Recombinant Human Interleukin-9
IL 9 HEK cyt-099 Hystemcell.cn Recombinant Human Interleukin 9, HEK
mIL 9 cyt-373 Hystemcell.cn Recombinant Mouse Interleukin-9
rIL 9 cyt-748 Hystemcell.cn Recombinant Rat Interleukin-9
IL 10 cyt-500 Hystemcell.cn Recombinant Human Interleukin-10
IL 10 His cyt-486 Hystemcell.cn Recombinant Human Interleukin-10, His Tag
IL 10 HEK cyt-100 Hystemcell.cn Recombinant Human Interleukin 10, HEK
mIL 10 cyt-497 Hystemcell.cn Recombinant Mouse Interleukin-10
rIL 10 cyt-465 Hystemcell.cn Recombinant Rat Interleukin-10
pIL 10 cyt-404 Hystemcell.cn Recombinant Porcine Interleukin-10
IL 11 cyt-214 Hystemcell.cn Recombinant Human Interleukin-11
IL 11 Pichia cyt-013 Hystemcell.cn Recombinant Human Interleukin-11, Pichia
mIL 11 cyt-646 Hystemcell.cn Recombinant Mouse Interleukin-11
IL 12 cyt-101 Hystemcell.cn Recombinant Human Interleukin 12
IL 12 p35 His cyt-487 Hystemcell.cn Recombinant Human Interleukin-12 p35, His Tag
IL 12 p40 Baculovirus cyt-134 Hystemcell.cn Recombinant Human Interleukin-12 p40, Baculovirus
IL 12 p40 His cyt-488 Hystemcell.cn Recombinant Human Interleukin-12 p40, His Tag
IL 12 p40 Plant cyt-056 Hystemcell.cn Recombinant Human Interleukin-12 p40, Plant
mIL 12 cyt-144 Hystemcell.cn Recombinant Mouse Interleukin-12
rIL 12 cyt-390 Hystemcell.cn Recombinant Rat Interleukin-12
IL 13 cyt-446 Hystemcell.cn Recombinant Human Interleukin-13
IL 13 Variant cyt-682 Hystemcell.cn Recombinant Human Interleukin-13 Variant
IL 13 His cyt-489 Hystemcell.cn Recombinant Human Interleukin-13, His Tag
mIL 13 cyt-375 Hystemcell.cn Recombinant Mouse Interleukin-13
rIL 13 cyt-391 Hystemcell.cn Recombinant Rat Interleukin-13
rIL 13 109 a.a. cyt-182 Hystemcell.cn Recombinant Rat Interleukin-13 109 a.a.
rmIL 13 cyt-175 Hystemcell.cn Recombinant Rhesus Macaque Interleukin-13
IL 15 cyt-230 Hystemcell.cn Recombinant Human Interleukin-15
IL 15 His cyt-490 Hystemcell.cn Recombinant Human Interleukin-15, His Tag
mIL 15 cyt-344 Hystemcell.cn Recombinant Mouse Interleukin-15
mIL 15 His cyt-647 Hystemcell.cn Recombinant Mouse Interleukin-15, His Tag
rIL 15 cyt-345 Hystemcell.cn Recombinant Rat Interleukin-15
pIL 15 cyt-403 Hystemcell.cn Recombinant Porcine Interleukin-15
IL 16, (130 a.a.) cyt-536 Hystemcell.cn Recombinant Human Interleukin-16, (130 a.a.)
IL 16, (121 a.a.) cyt-142 Hystemcell.cn Recombinant Human Interleukin-16, (121 a.a.)
IL 16 His cyt-562 Hystemcell.cn Recombinant Human Interleukin-16, His Tag
mIL 16 cyt-559 Hystemcell.cn Recombinant Mouse Interleukin-16
maIL 16 cyt-153 Hystemcell.cn Recombinant Rhesus Macaque Interleukin-16
IL 17A cyt-250 Hystemcell.cn Recombinant Human Interleukin-17A
IL 17A His cyt-662 Hystemcell.cn Recombinant Human Interleukin-17A His Tag
IL 17A HEK cyt-102 Hystemcell.cn Recombinant Human Interleukin 17A, HEK
IL 17E cyt-583 Hystemcell.cn Recombinant Human Interleukin-17E
IL 17F cyt-587 Hystemcell.cn Recombinant Human Interleukin-17F
IL 17F HEK cyt-103 Hystemcell.cn Recombinant Human Interleukin 17F, HEK
IL 17 A/F cyt-623 Hystemcell.cn Recombinant Human Interleukin-17 A/F Heterodimer
mIL 17 cyt-378 Hystemcell.cn Recombinant Mouse Interleukin-17A
mIL 17E cyt-641 Hystemcell.cn Recombinant Mouse Interleukin-17E
mIL 17F cyt-642 Hystemcell.cn Recombinant Mouse Interleukin-17F
mIL 17 A/F cyt-640 Hystemcell.cn Recombinant Mouse Interleukin-17 A/F Heterodimer
rIL 17 A/F cyt-677 Hystemcell.cn Recombinant Rat Interleukin-17 A/F Heterodimer
rIL 17 cyt-542 Hystemcell.cn Recombinant Rat Interleukin-17A
rIL 17E cyt-576 Hystemcell.cn Recombinant Rat Interleukin-17E
rIL 17F cyt-643 Hystemcell.cn Recombinant Rat Interleukin-17F
IL 18 cyt-269 Hystemcell.cn Recombinant Human Interleukin-18
IL 18 His cyt-663 Hystemcell.cn Recombinant Human Interleukin-18 His Tag
IL18BP cyt-728 Hystemcell.cn Recombinant Human Interleukin-18 Binding Protein
mIL 18 cyt-634 Hystemcell.cn Recombinant Mouse Interleukin-18
rIL 18 cyt-376 Hystemcell.cn Recombinant Rat Interleukin-18
IL 19 cyt-363 Hystemcell.cn Recombinant Human Interleukin-19
mIL 19 cyt-411 Hystemcell.cn Recombinant Mouse Interleukin-19
IL 20 cyt-347 Hystemcell.cn Recombinant Human Interleukin-20
mIL 20 cyt-379 Hystemcell.cn Recombinant Mouse Interleukin-20
IL 21 cyt-408 Hystemcell.cn Recombinant Human Interleukin-21
mIL 21 cyt-684 Hystemcell.cn Recombinant Mouse Interleukin-21
rIL 21 cyt-033 Hystemcell.cn Recombinant Rat Interleukin-21
IL 22 cyt-328 Hystemcell.cn Recombinant Human Interleukin-22
mIL 22 cyt-539 Hystemcell.cn Recombinant Mouse Interleukin-22
rIL 22 cyt-173 Hystemcell.cn Recombinant Rat Interleuikin-22
mIL 22 PEG cyt-701 Hystemcell.cn Recombinant Mouse Interleukin-22, Pegylated
mIL 22A cyt-148 Hystemcell.cn Recombinant Mouse Interleukin-22 Antagonist (E117A)
IL 23 cyt-050 Hystemcell.cn Recombinant Human Interleukin-23
IL 23 His cyt-067 Hystemcell.cn Recombinant Human Interleukin-23, His Tag
IL 24 cyt-515 Hystemcell.cn Recombinant Human Interleukin-24
IL 27 cyt-048 Hystemcell.cn Recombinant Human Interleukin-27 p28
mIL 27 cyt-570 Hystemcell.cn Recombinant Mouse Interleukin-27
IL 28A cyt-602 Hystemcell.cn Recombinant Human Interleukin-28A
IL 28A HEK cyt-104 Hystemcell.cn Recombinant Human Interleukin-28A, HEK
mIL 28A cyt-741 Hystemcell.cn Recombinant Mouse Interleukin-28A
IL 28B cyt-105 Hystemcell.cn Recombinant Human Interleukin-28B
mIL 28B cyt-732 Hystemcell.cn Recombinant Mouse Interleukin-28B
IL 29 cyt-603 Hystemcell.cn Recombinant Human Interleukin-29
IL 29 HEK cyt-117 Hystemcell.cn Recombinant Human Interleukin-29, HEK
IL 31 cyt-625 Hystemcell.cn Recombinant Human Interleukin-31
mIL 31 cyt-604 Hystemcell.cn Recombinant Mouse Interleukin-31
IL 32A cyt-584 Hystemcell.cn Recombinant Human IL-32 alpha
IL 32A His Tag cyt-648 Hystemcell.cn Recombinant Human IL-32 alpha His Tag
IL 33 cyt-425 Hystemcell.cn Recombinant Human Interleukin-33
IL 33 His cyt-667 Hystemcell.cn Recombinant Human Interleukin-33 His Tag
mIL 33 cyt-655 Hystemcell.cn Recombinant Mouse Interleukin-33
rIL 33 cyt-150 Hystemcell.cn Recombinant Rat Interleukin-33
IL34 cyt-042 Hystemcell.cn Recombinant Human Interleukin-34
IL36RN cyt-009 Hystemcell.cn Recombinant Human Interleukin-36 Receptor Antagonist
mIL36RN cyt-154 Hystemcell.cn Recombinant Mouse Interleukin-36 Receptor Antagonist
IL36A cyt-158 Hystemcell.cn Recombinant Human Interleukin-36 Alpha
IL36A 158 a.a. cyt-179 Hystemcell.cn Recombinant Human Interleukin-36 Alpha 158 a.a.
mIL36A cyt-162 Hystemcell.cn Recombinant Mouse Interleukin-36 Alpha
mIL36A 153 a.a. cyt-181 Hystemcell.cn Recombinant Mouse Interleukin-36 Alpha 153 a.a.
IL36B cyt-159 Hystemcell.cn Recombinant Human Interleukin-36 Beta
IL36B 153 a.a. cyt-180 Hystemcell.cn Recombinant Human Interleukin-36 Beta 153 a.a
mIL36B cyt-165 Hystemcell.cn Recombinant Mouse Interleukin-36 Beta
IL36G cyt-160 Hystemcell.cn Recombinant Human Interleukin-36 Gamma
IL36G 152 a.a. cyt-161 Hystemcell.cn Recombinant Human Interleukin-36 Gamma 152 a.a.
mIL36G cyt-745 Hystemcell.cn Recombinant Mouse Interleukin-36 Gamma
IL37 cyt-011 Hystemcell.cn Recombinant Human Interleukin 37
IL1F10 cyt-012 Hystemcell.cn Recombinant Human Interleukin 1 Family, Member 10
Insulin cyt-270 Hystemcell.cn Recombinant Human Insulin
Insulin Yeast cyt-614 Hystemcell.cn Recombinant Human Insulin Yeast
pInsulin cyt-468 Porcine Insulin
KGF cyt-219 Hystemcell.cn Recombinant Human Keratinocyte Growth Factor
mKGF cyt-721 Hystemcell.cn Recombinant Mouse Keratinocyte Growth Factor
KGF HEK cyt-086 Hystemcell.cn Recombinant Human Keratinocyte Growth Factor, HEK
KGF 2 cyt-303 Hystemcell.cn Recombinant Human Keratinocyte Growth Factor-2
KGF 2 His cyt-129 Hystemcell.cn Recombinant Human Keratinocyte Growth Factor-2, His Tag
mKGF 2 cyt-126 Hystemcell.cn Recombinant Mouse Keratinocyte Growth Factor-2
rKGF cyt-127 Hystemcell.cn Recombinant Rat Keratinocyte Growth Factor-2
Leptin cyt-228 Hystemcell.cn Recombinant Human Leptin
Leptin cyt-683 Human Leptin
Leptin His cyt-287 Hystemcell.cn Recombinant Human Leptin, His Tag
mLeptin cyt-351 Hystemcell.cn Recombinant Mouse Leptin
mLeptin PEG cyt-591 Hystemcell.cn Recombinant Pegylated Mouse Leptin
rLeptin cyt-227 Hystemcell.cn Recombinant Rat Leptin
rLeptin PEG cyt-592 Hystemcell.cn Recombinant Pegylated Rat Leptin
oLeptin cyt-239 Hystemcell.cn Recombinant Ovine Leptin
oLeptin, MTS cyt-531 Hystemcell.cn Recombinant Ovine Leptin, MTS tag
bLeptin cyt-502 Hystemcell.cn Recombinant Bovine Leptin
pLeptin cyt-503 Hystemcell.cn Recombinant Porcine Leptin
pfLeptin cyt-530 Hystemcell.cn Recombinant Pufferfish Leptin
sLeptin cyt-704 Hystemcell.cn Recombinant Salamander Leptin
hLeptin cyt-504 Hystemcell.cn Recombinant Horse Leptin
chLeptin cyt-505 Hystemcell.cn Recombinant Chicken Leptin
dLeptin cyt-506 Hystemcell.cn Recombinant Dog Leptin
raLeptin cyt-507 Hystemcell.cn Recombinant Rabbit Leptin
Leptin tA cyt-352 Hystemcell.cn Recombinant Human Leptin Triple Antagonist
Leptin tA PEG cyt-702 Hystemcell.cn Recombinant Human Leptin Triple Antagonist, Pegylated
Leptin qA cyt-353 Hystemcell.cn Recombinant Human Leptin Quadruple Antagonist
mLeptin tA cyt-354 Hystemcell.cn Recombinant Mouse Leptin Triple Antagonist
mLeptin tA PEG cyt-566 Hystemcell.cn Recombinant Pegylated Mouse Leptin Triple Antagonist, Pegylated
rLeptin tA cyt-355 Hystemcell.cn Recombinant Rat Leptin Triple Antagonist
rLeptin tA PEG cyt-567 Hystemcell.cn Recombinant Pegylated Rat Leptin Triple Antagonist, Pegylated
oLeptin tA cyt-356 Hystemcell.cn Recombinant Ovine Leptin Triple Antagonist
oLeptin tA PEG cyt-703 Hystemcell.cn Recombinant Ovine Leptin Triple Antagonist, Pegylated
oLeptin qA cyt-357 Hystemcell.cn Recombinant Ovine Leptin Quadruple Antagonist
Leptin Receptor cyt-508 Hystemcell.cn Recombinant Human Leptin Binding Domain
chLeptin Receptor cyt-509 Hystemcell.cn Recombinant Chicken Leptin Binding Domain
LFA 3 cyt-423 Hystemcell.cn Recombinant Human Leukocyte Function Associated Antigen-3 Fusion Protein
LIF cyt-644 Hystemcell.cn Recombinant Human Leukemia Inhibitory Factor
mLIF cyt-645 Hystemcell.cn Recombinant Mouse Leukemia Inhibitory Factor
LIF GST cyt-001 Hystemcell.cn Recombinant Human Leukemia Inhibitory Factor, GST tag
rLIF cyt-731 Hystemcell.cn Recombinant Rat Leukemia Inhibitory Factor
MANF, His cyt-133 Hystemcell.cn Recombinant Human Mesencephalic Astrocyte-Derived Neurotrophic Factor, His Tag
MANF cyt-141 Hystemcell.cn Recombinant Human Mesencephalic Astrocyte-Derived Neurotrophic Factor
M CSF cyt-308 Hystemcell.cn Recombinant Human Macrophage Colony Stimulating Factor
M CSF Baculovirus cyt-637 Hystemcell.cn Recombinant Human Macrophage Colony Stimulating Factor, Baculovirus
M CSF HEK cyt-106 Hystemcell.cn Recombinant Human Macrophage Colony Stimulating Factor, HEK
M CSF His cyt-695 Hystemcell.cn Recombinant Human Macrophage Colony Stimulating Factor, His Tag
mM CSF cyt-439 Hystemcell.cn Recombinant Mouse Macrophage Colony Stimulating Factor
rM CSF cyt-046 Hystemcell.cn Recombinant Rat Macrophage Colony Stimulating Factor
MIF cyt-575 Hystemcell.cn Recombinant Human Macrophage Migration Inhibitor Factor
MIF (Active) cyt-596 Hystemcell.cn Recombinant Human Macrophage Migration Inhibitor Factor
MIF His N cyt-431 Hystemcell.cn Recombinant Human Macrophage Migration Inhibitor Factor, His Tag N-Terminus
MIF His C cyt-521 Hystemcell.cn Recombinant Human Macrophage Migration Inhibitor Factor, His Tag C-Terminus
mMIF cyt-744 Hystemcell.cn Recombinant Mouse Macrophage Migration Inhibitor Factor
rMIF cyt-193 Hystemcell.cn Recombinant Rat Macrophage Migration Inhibitor Factor
MIA cyt-310 Hystemcell.cn Recombinant Human Melanoma Inhibitory Activity Protein
MIA2 cyt-638 Hystemcell.cn Recombinant Human Melanoma Inhibitory Activity Protein 2
Midkine cyt-192 Hystemcell.cn Recombinant Human Midkine
Midkine, His cyt-444 Hystemcell.cn Recombinant Human Midkine, His Tag
mMidkine cyt-178 Hystemcell.cn Recombinant Mouse Midkine
rMidkine cyt-747 Hystemcell.cn Recombinant Rat Midkine
MTPN cyt-723 Hystemcell.cn Recombinant Human Myotrophin
Myostatin cyt-418 Hystemcell.cn Recombinant Human Myostatin
Myostatin His cyt-445 Hystemcell.cn Recombinant Human Myostatin, His-Tag
Myostatin Propetide cyt-448 Hystemcell.cn Recombinant Human Myostatin Propeptide
Myostatin Plant cyt-055 Hystemcell.cn Recombinant Human Myostatin, Plant
NGB cyt-450 Hystemcell.cn Recombinant Human Neuroglobin
NRG1 cyt-407 Hystemcell.cn Recombinant Human Neuregulin-1/Heregulin-b2
NRG1 B1 cyt-733 Hystemcell.cn Recombinant Human Neuregulin-1/Heregulin-b1
NRG1 A cyt-736 Hystemcell.cn Recombinant Human Neuregulin-1/Heregulin Alpha (EGF Domain)
NT 3 cyt-257 Hystemcell.cn Recombinant Human Neurotrophin-3
proNT3 cyt-015 Hystemcell.cn Recombinant Human Precursor Neurotrophin-3
mNT 3 cyt-688 Hystemcell.cn Recombinant Mouse Neurotrophin-3
NT 4 cyt-626 Hystemcell.cn Recombinant Human Neurotrophin-4
Noggin cyt-475 Hystemcell.cn Recombinant Human Noggin
Noggin HEK cyt-107 Hystemcell.cn Recombinant Human Noggin, HEK
mNoggin cyt-600 Hystemcell.cn Recombinant Mouse Noggin
Omentin cyt-301 Hystemcell.cn Recombinant Human Omentin
Omentin His cyt-551 Hystemcell.cn Recombinant Human Omentin His Tag
Omentin 298 a.a. cyt-061 Hystemcell.cn Recombinant Human Omentin 298 a.a.
OPG Fc cyt-266 Hystemcell.cn Recombinant Human Osteoprotegerin/Fc Chimera
OPG cyt-177 Hystemcell.cn Recombinant Human Osteoprotegerin
OPG His cyt-290 Hystemcell.cn Recombinant Human Osteoprotegerin, His Tag
OPG Hi-5 cyt-633 Hystemcell.cn Recombinant Human Osteoprotegerin Hi-5
OSM cyt-231 Hystemcell.cn Recombinant Human Oncostatin-M
OSM (209 a.a.) cyt-639 Hystemcell.cn Recombinant Human Oncostatin-M (209 a.a.)
OSM (195 a.a.) cyt-735 Hystemcell.cn Recombinant Human Oncostatin-M (195 a.a.)
OSM, His cyt-060 Hystemcell.cn Recombinant Human Oncostatin-M, His Tag
OSM HEK cyt-108 Hystemcell.cn Recombinant Human Oncostatin-M, HEK
mOSM cyt-168 Hystemcell.cn Recombinant Mouse Oncostatin-M
rOSM cyt-169 Hystemcell.cn Recombinant Rat Oncostatin-M
OSTF1 cyt-630 Hystemcell.cn Recombinant Human Osteoclast Stimulating Factor-1
OTOR cyt-582 Hystemcell.cn Recombinant Human Otoraplin
PDGF AA cyt-341 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-AA
PDGF AA Yeast cyt-568 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-AA, Yeast
PDGF AA HEK cyt-109 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-AA HEK
PDGF A cyt-491 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-A
mPDGF AA cyt-590 Hystemcell.cn Recombinant Mouse Plaet Derived Growth Factor-AA
PDGF AB cyt-342 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-AB
PDGF BB cyt-501 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-BB
PDGF B cyt-492 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-B
mPDGF BB cyt-412 Hystemcell.cn Recombinant Mouse Plaet Derived Growth Factor-BB
rPDGF BB cyt-740 Hystemcell.cn Recombinant Rat Plaet Derived Growth Factor-BB
PDGFD cyt-155 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-D
PDGFRA cyt-065 Hystemcell.cn Recombinant Human Plaet-Derived Growth Factor Receptor, Alpha
PEDF cyt-580 Hystemcell.cn Recombinant Human Pigment Epithelium-Derived Factor
PEDF His cyt-552 Hystemcell.cn Recombinant Human Pigment Epithelium-Derived Factor, His Tag
PEDF HEK cyt-553 Hystemcell.cn Recombinant Human Pigment Epithelium-Derived Factor, HEK
Periostin cyt-452 Hystemcell.cn Recombinant Human Periostin
PGRN cyt-524 Hystemcell.cn Recombinant Human Progranulin
Pleiotrophin cyt-451 Hystemcell.cn Recombinant Human Pleiotrophin
Pleiotrophin HEK cyt-198 Hystemcell.cn Recombinant Human Pleiotrophin, HEK
Placental Lactogen cyt-656 Hystemcell.cn Recombinant Human Placental Lactogen
bPlacental Lactogen cyt-511 Hystemcell.cn Recombinant Bovine Placental Lactogen
oPlacental Lactogen cyt-512 Hystemcell.cn Recombinant Ovine Placental Lactogen
cPlacental Lactogen cyt-510 Hystemcell.cn Recombinant Caprine Placental Lactogen
PLGF 1 cyt-419 Hystemcell.cn Recombinant Human Placenta Growth Factor-1
PLGF 2 cyt-420 Hystemcell.cn Recombinant Human Placenta Growth Factor-2
Prolactin cyt-267 Hystemcell.cn Recombinant Human Prolactin
Prolactin His cyt-493 Hystemcell.cn Recombinant Human Prolactin, His Tag
mProlactin cyt-321 Hystemcell.cn Recombinant Mouse Prolactin
rProlactin cyt-322 Hystemcell.cn Recombinant Rat Prolactin
oProlactin cyt-240 Hystemcell.cn Recombinant Ovine Prolactin
raProlactin cyt-513 Hystemcell.cn Recombinant Rabbit Prolactin
Prl R, GST cyt-469 Hystemcell.cn Recombinant Human Prolactin Receptor , GST Tag
Prl R cyt-595 Hystemcell.cn Recombinant Human Prolactin Receptor
raPrl R cyt-268 Hystemcell.cn Recombinant Rabbit Prolactin Soluble Receptor
oPrl R cyt-293 Hystemcell.cn Recombinant Ovine Prolactin Soluble Receptor
bPrl R cyt-294 Hystemcell.cn Recombinant Bovine Prolactin Soluble Receptor
tPrl R cyt-532 Hystemcell.cn Recombinant Raibow Trout Prolactin Soluble Receptor
rPrl R cyt-533 Hystemcell.cn Recombinant Rat Prolactin Soluble Receptor
oPrl A cyt-311 Hystemcell.cn Recombinant Ovine Prolactin Antagonist
oPrl A Mutant cyt-705 Hystemcell.cn Recombinant Ovine Prolactin Antagonist, Mutant
sCD4 cyt-304 Hystemcell.cn Recombinant Human Soluble CD4
CD4 (26-226) cyt-313 Hystemcell.cn Recombinant Human CD4 (26-226)
CD4 (125-202) cyt-315 Hystemcell.cn Recombinant Human CD4 (125-202)
CD4 (203-317) cyt-316 Hystemcell.cn Recombinant Human CD4 (203-317)
sCD40L cyt-245 Hystemcell.cn Recombinant Human soluble CD40 Ligand/TRAP
sCD40L His cyt-670 Hystemcell.cn Recombinant Human soluble CD40 Ligand/TRAP His Tag
msCD40L cyt-472 Hystemcell.cn Recombinant Mouse soluble CD40 Ligand/TRAP
SCGB1A1 cyt-743 Hystemcell.cn Recombinant Human Uteroglobin
mSCGB1A1 cyt-746 Hystemcell.cn Recombinant Mouse Uteroglobin
SHH cyt-676 Hystemcell.cn Recombinant Human Sonic HedgeHog
SHH, His cyt-717 Hystemcell.cn Recombinant Human Sonic HedgeHog, His Tag
mSHH cyt-597 Hystemcell.cn Recombinant Mouse Sonic HedgeHog
mSHH, His cyt-711 Hystemcell.cn Recombinant Mouse Sonic HedgeHog, His Tag
DHH cyt-467 Hystemcell.cn Recombinant Human Desert HedgeHog
DHH (C23II) cyt-362 Hystemcell.cn Recombinant Human Desert HedgeHog (C23II)
sRANKL cyt-334 Hystemcell.cn Recombinant Human Soluble RANK Ligand
sRANKL His cyt-692 Hystemcell.cn Recombinant Human Soluble RANK Ligand, His Tag
sRANKL GST cyt-631 Hystemcell.cn Recombinant Human Soluble RANK Ligand, GST Tag
msRANKL cyt-320 Hystemcell.cn Recombinant Mouse Soluble RANK Ligand
sRANK Receptor cyt-734 Hystemcell.cn Recombinant Human Soluble RANK Receptor
mRELM a cyt-309 Hystemcell.cn Recombinant Mouse RELM-alpha
mRELM a His cyt-453 Hystemcell.cn Recombinant Mouse RELM-alpha His Tag
RELM b cyt-454 Hystemcell.cn Recombinant Human RELM-beta
mRELM b cyt-413 Hystemcell.cn Recombinant Mouse RELM-beta
mRELM g cyt-455 Hystemcell.cn Recombinant Mouse RELM-Gamma
Resistin cyt-456 Hystemcell.cn Recombinant Human Resistin
Resistin His cyt-256 Hystemcell.cn Recombinant Human Resistin, His Tag
Resistin Mutant cyt-585 Hystemcell.cn Recombinant Human Resistin Mutant
mResistin cyt-457 Hystemcell.cn Recombinant Mouse Resistin
rResistin cyt-458 Hystemcell.cn Recombinant Rat Resistin
RBP1 cyt-122 Hystemcell.cn Recombinant Human Retinol Binding Protein-1
RBP4 cyt-535 Hystemcell.cn Recombinant Human Retinol Binding Protein-4
RBP4 His cyt-555 Hystemcell.cn Recombinant Human Retinol Binding Protein-4 His Tag
RBP5 cyt-650 Hystemcell.cn Recombinant Human Retinol Binding Protein-5
RBP7 cyt-023 Hystemcell.cn Recombinant Human Retinol Binding Protein-7
SAA1 cyt-675 Hystemcell.cn Recombinant Human Serum Amyloid A (APO-SAA1)
rmSAA1 cyt-719 Hystemcell.cn Recombinant Rhesus Macaque Serum Amyloid A (APO-SAA1)
SAA4 cyt-002 Hystemcell.cn Recombinant Human Serum Amyloid A4
SCF cyt-255 Hystemcell.cn Recombinant Human Stem Cell Factor
mSCF cyt-275 Hystemcell.cn Recombinant Mouse Stem Cell Factor
rSCF cyt-323 Hystemcell.cn Recombinant Rat Stem Cell Factor
SCF Sf9 cyt-421 Hystemcell.cn Recombinant Human Stem Cell Factor, Sf9
SCF HEK cyt-111 Hystemcell.cn Recombinant Human Stem Cell Factor, HEK
k9SCF cyt-194 Hystemcell.cn Recombinant Canine Stem Cell Factor
SF20 cyt-622 Hystemcell.cn Recombinant Human Chromosome 19 Open Reading Frame 10
mSF20 cyt-678 Hystemcell.cn Recombinant Mouse Chromosome 19 Open Reading Frame 10
SPP1 cyt-635 Hystemcell.cn Recombinant Human Osteopontin
SPP1 HEK cyt-047 Hystemcell.cn Recombinant Human Osteopontin, HEK
TACI cyt-032 Hystemcell.cn Recombinant Human Tumor Necrosis Factor Receptor 13B
TAFA2 cyt-118 Hystemcell.cn Recombinant Human Family with Sequence Similarity 19 Member A2
TDGF1 cyt-712 Hystemcell.cn Recombinant Human Teratocarcinoma-Derived Growth Factor 1
TFF1 cyt-586 Hystemcell.cn Recombinant Human Trefoil Factor-1
TFF1 His cyt-610 Hystemcell.cn Recombinant Human Trefoil Factor-1 His Tag
TFF2 cyt-612 Hystemcell.cn Recombinant Human Trefoil Factor-2
TFF2 His cyt-611 Hystemcell.cn Recombinant Human Trefoil Factor-2 His Tag
TFF3 cyt-005 Hystemcell.cn Recombinant Human Trefoil Factor-3
TFF3 His cyt-616 Hystemcell.cn Recombinant Human Trefoil Factor-3 His Tag
TGF b 1 cyt-716 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 1
TGF b 1 cyt-561 Human Transforming Growth Factor-Beta 1
TGF b 1 GST cyt-473 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 1, GST tag
TGF b 1 His cyt-672 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 1 His Tag
TGF b 1 (113 a.a.) cyt-679 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 1 (113 a.a.)
TGF b 2 cyt-441 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 2
TGF b 2 HEK cyt-112 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 2, HEK
TGF b 3 cyt-368 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 3
TGF b 3 CHO cyt-685 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 3, CHO
TGF b 3 Plant cyt-588 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 3, Plant
TGF b 3 HEK cyt-113 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 3, HEK
TGF b 3 (207 a.a.) cyt-319 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 3 (644-850)
mTGF b 3 cyt-143 Hystemcell.cn Recombinant Mouse Transforming Growth Factor-Beta 3
4 1BBR cyt-463 Hystemcell.cn Recombinant Human 4-1BB Receptor
4 1BBR, His cyt-137 Hystemcell.cn Recombinant Human 4-1BB Receptor His Tag
4 1BBL cyt-149 Hystemcell.cn Recombinant Human 4-1BB Ligand
4 1BBL, His cyt-649 Hystemcell.cn Recombinant Human 4-1BB Ligand, His Tag
TNF a cyt-223 Hystemcell.cn Recombinant Human Tumor Necrosis Factor-alpha
TNF a His cyt-494 Hystemcell.cn Recombinant Human Tumor Necrosis Factor-alpha, His Tag
TNF a HEK cyt-114 Hystemcell.cn Recombinant Human Tumor Necrosis Factor-alpha, HEK
mTNF a cyt-252 Hystemcell.cn Recombinant Mouse Tumor Necrosis Factor-alpha
rTNF a cyt-393 Hystemcell.cn Recombinant Rat Tumor Necrosis Factor-alpha
rpTNF a cyt-405 Hystemcell.cn Recombinant Porcine Tumor Necrosis Factor-alpha
raTNF a cyt-008 Hystemcell.cn Recombinant Rabbit Tumor Necrosis Factor-alpha
rCaTNF a cyt-140 Hystemcell.cn Recombinant Canine Tumor Necrosis Factor-alpha
rmTNF a cyt-737 Hystemcell.cn Recombinant Rhesus Macaque Tumor Necrosis Factor-alpha
TNF a Mutant cyt-384 Hystemcell.cn Recombinant Human Tumor Necrosis Factor-alpha, Mutant
TNF b cyt-224 Hystemcell.cn Recombinant Human Tumor Necrosis Factor-beta
TNF b His cyt-495 Hystemcell.cn Recombinant Human Tumor Necrosis Factor-beta, His Tag
TNFR2 cyt-674 Hystemcell.cn Recombinant Human Tumor Necrosis Factor Receptor Type 2
TNFR2 Fc cyt-422 Hystemcell.cn Recombinant Human Tumor Necrosis Factor Receptor 2 Fusion Protein
TNFRSF17 cyt-598 Hystemcell.cn Recombinant Human B-Cell Maturation Antigen
TNFRSF17, His cyt-190 Hystemcell.cn Recombinant Human B-Cell Maturation Antigen, His Tag
TNFR cyt-707 Hystemcell.cn Recombinant Human Tumor Necrosis Factor Receptor
TNFR His cyt-673 Hystemcell.cn Recombinant Human Tumor Necrosis Factor Receptor Type His Tag
TNFSF12 cyt-699 Hystemcell.cn Recombinant Human TNF Ligand Superfamily Member 12
TNFRSF10B cyt-069 Hystemcell.cn Recombinant Human TNF Ligand Receptor Superfamily Member 10B
TNFRSF12A cyt-043 Hystemcell.cn Recombinant Human TNF Ligand Receptor Superfamily Member 12A
TSLP cyt-572 Hystemcell.cn Recombinant Human Thymic Stromal Lymphopoietin
TSLPR cyt-742 Hystemcell.cn Recombinant Human Thymic Stromal Lymphopoietin Receptor
TPO cyt-302 Hystemcell.cn Recombinant Human Thrombopoietin
TPO CHO cyt-462 Hystemcell.cn Recombinant Human Thrombopoietin, CHO
TPO HEK cyt-115 Hystemcell.cn Recombinant Human Thrombopoietin, HEK
mTPO cyt-346 Hystemcell.cn Recombinant Mouse Thrombopoietin
TRAIL cyt-443 Hystemcell.cn Recombinant Human TNF-Related Apoptosis Inducing Ligand/Apo2L
TRAIL (114-281 a.a.) cyt-546 Hystemcell.cn Recombinant Human TNF-Related Apoptosis Inducing Ligand/Apo2L (114-281)
ULBP1 cyt-166 Hystemcell.cn Recombinant Human UL16 Binding Protein 1
Vaspin cyt-459 Hystemcell.cn Recombinant Human Vaspin
VEGF cyt-241 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor
VEGF His cyt-496 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor, His Tag
VEGF CHO cyt-260 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor, CHO
VEGF HEK cyt-225 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor, HEK
VEGF Yeast cyt-577 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor, Yeast
VEGF (121a.a.) cyt-343 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor (121)
VEGF (121a.a.) Sf9 cyt-200 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor (121), Sf9
VEGF (121a.a.) His cyt-619 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor (121), His Tag
VEGF (121a.a.) HEK cyt-116 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor (121), HEK
rmVEGF cyt-336 Hystemcell.cn Recombinant Mouse Vascular Endothelial Growth Factor
mVEGF Sf9 cyt-226 Hystemcell.cn Recombinant Mouse Vascular Endothelial Growth Factor-Sf9
rmVEGF (121a.a.) cyt-574 Hystemcell.cn Recombinant Mouse Vascular Endothelial Growth Factor (121)
rmVEGF His cyt-680 Hystemcell.cn Recombinant Mouse Vascular Endothelial Growth Factor, His Tag
rVEGF cyt-392 Hystemcell.cn Recombinant Rat Vascular Endothelial Growth Factor
VEGFB cyt-628 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor B
VEGF C cyt-527 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor Related Protein
rVEGF C cyt-262 Hystemcell.cn Recombinant Rat Vascular Endothelial Growth Factor Related Protein
rVEGF C (152a.a.) cyt-284 Hystemcell.cn Recombinant Rat Vascular Endothelial Growth Factor-C (152)
VEGF D cyt-045 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor D
VEGF E (Orf Virus) cyt-263 Hystemcell.cn Recombinant Vascular Endothelial Growth Factor-E (Orf Virus)
VEGI cyt-517 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Inhibitor
VEGI His cyt-589 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Inhibitor, His Tag
Visfatin cyt-318 Hystemcell.cn Recombinant Human Visfatin
Visfatin His cyt-563 Hystemcell.cn Recombinant Human Visfatin, His Tag
mVisfatin cyt-447 Hystemcell.cn Recombinant Mouse Visfatin
重慶市華雅干細胞技術有限公司 ：